Anti-TROY Rabbit Monoclonal Antibody [clone: ARC2393]
Rabbit monoclonal [ARC2393] antibody to TROY for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:1,000
Type: Primary
Antigen: TROY
Clonality: Monoclonal
Clone: ARC2393
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
- Catalog No:
- 77229-940
- Antigen Symbol:
- TROY
- Antigen Name:
- AL023044
- Antigen Synonyms:
- TAJ-alpha|TAJ alpha|TRADE|TNFRSF19|AW123854|TNFRSF19 tumor necrosis factor receptor superfamily, member 19|TNR19_HUMAN|Toxicity and JNK inducer|TAJ
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC2393
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9NS68
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68)
- Sequence:
- RFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK
- Form:
- Liquid
- Molecular Weight:
- 46 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C