Order Entry
Puerto Rico
ContactUsLinkComponent
 
Anti-TROY Rabbit Monoclonal Antibody [clone: ARC2393]
 
undefined
Anti-TROY Rabbit Monoclonal Antibody [clone: ARC2393]

 

  • Catalog No:
  • 77229-940
  • Antigen Symbol:
  • TROY
  • Antigen Name:
  • AL023044
  • Antigen Synonyms:
  • TAJ-alpha|TAJ alpha|TRADE|TNFRSF19|AW123854|TNFRSF19 tumor necrosis factor receptor superfamily, member 19|TNR19_HUMAN|Toxicity and JNK inducer|TAJ
  • Antibody Type:
  • Primary
  • Clonality:
  • Monoclonal
  • Conjugation:
  • Unconjugated
  • Clone:
  • ARC2393
  • Reactivity:
  • Human, Rat, Mouse
  • Host:
  • Rabbit
  • Gene ID:
  • UniprotID# Q9NS68
  • Isotype:
  • IgG
  • Western Blot:
  • Yes
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68)
  • Sequence:
  • RFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK
  • Form:
  • Liquid
  • Molecular Weight:
  • 46 kDa
  • Purification:
  • Affinity purification
  • Storage Buffer:
  • Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
  • Storage Temperature:
  • Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
  • Shipping Temperature:
  • Shipped on blue ice at 4 °C