Anti-GPRC5A Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to GPRC5A for WB with samples derived from Human and Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: GPRC5A
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse
Specifications
- Catalog No:
- 76854-016
- Antigen Symbol:
- GPRC5A
- Antigen Name:
- G protein coupled receptor family C group 5 member A
- Antigen Synonyms:
- GPCR5A|GPCR 5A|G-protein coupled receptor family C group 5 member A|Gprc5a|Orphan G-protein-coupling receptor PEIG-1|RAI 3|Orphan G protein coupling receptor PEIG 1|Orphan G protein coupling receptor PEIG1|Gprc 5a
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q8NFJ5
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 258 - 357 of human GPRC5A (NP_003970.1)
- Sequence:
- LAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
- Form:
- Liquid
- Molecular Weight:
- 37 - 50 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C