Anti-BHC80/PHF21A Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to BHC80 / PHF21A for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: BHC80/PHF21A
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
- Catalog No:
- 76857-858
- Antigen Symbol:
- BHC80/PHF21A
- Antigen Name:
- BHC80 / PHF21A
- Antigen Synonyms:
- BRAF35-HDAC complex protein BHC80|KIAA1696|BHC80/PHF21A|BHC80a|BRAF35/HDAC2 complex (80 kDa)|PHD finger protein 21A|BM-006|PF21A_HUMAN
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q96BD5
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 461 - 680 of human PHF21A (NP_001095272.1)
- Sequence:
- TETTFTFPAPVQPVSLPSPTSTDGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLAIVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQGEETK
- Form:
- Liquid
- Molecular Weight:
- 70 - 80 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
Frequently Bought Together