Order Entry
Puerto Rico
ContactUsLinkComponent
 
Anti-BHC80/PHF21A Rabbit Polyclonal Antibody
 
undefined
Anti-BHC80/PHF21A Rabbit Polyclonal Antibody

 

  • Catalog No:
  • 76857-858
  • Antigen Symbol:
  • BHC80/PHF21A
  • Antigen Name:
  • BHC80 / PHF21A
  • Antigen Synonyms:
  • BRAF35-HDAC complex protein BHC80|KIAA1696|BHC80/PHF21A|BHC80a|BRAF35/HDAC2 complex (80 kDa)|PHD finger protein 21A|BM-006|PF21A_HUMAN
  • Antibody Type:
  • Primary
  • Clonality:
  • Polyclonal
  • Conjugation:
  • Unconjugated
  • Reactivity:
  • Human, Rat, Mouse
  • Host:
  • Rabbit
  • Gene ID:
  • UniprotID# Q96BD5
  • Isotype:
  • IgG
  • Western Blot:
  • Yes
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 461 - 680 of human PHF21A (NP_001095272.1)
  • Sequence:
  • TETTFTFPAPVQPVSLPSPTSTDGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIPWPGTLAIVHSYIAYKAAKEEEKQKLLKWSSDLKQEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQGEETK
  • Form:
  • Liquid
  • Molecular Weight:
  • 70 - 80 kDa
  • Purification:
  • Affinity purification
  • Storage Buffer:
  • Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
  • Storage Temperature:
  • Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
  • Shipping Temperature:
  • Shipped on blue ice at 4 °C

 

Frequently Bought Together