Rabbit polyclonal antibody to Lin28A for WB, IHC and ICC/IF with samples derived from Human and Mouse.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:100 to 1:500, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Lin28A
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
- Catalog No:
- 76866-142
- Antigen Symbol:
- Lin28A
- Antigen Name:
- CSDD1
- Antigen Synonyms:
- Lin28A|LIN28|FLJ12457|LN28A_HUMAN|Protein lin-28 homolog A|LIN 28|ZCCHC1|Lin 28 homolog A (C. elegans)|Lin-28A
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q9H9Z2
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 100 - 209 of human LIN28A (NP_078950.1)
- Sequence:
- SAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
- Form:
- Liquid
- Molecular Weight:
- 28 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
- Tested Applications:
- IHC, ICC/IF