Anti-RPP25L Rabbit Polyclonal Antibody
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit polyclonal antibody to RPP25L for WB with samples derived from Human.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: RPP25L
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human
Specifications
- Catalog No:
- 76868-458
- Antigen Symbol:
- RPP25L
- Antigen Name:
- Alba like protein C9orf23
- Antigen Synonyms:
- bA296L22.5|RPP25L|Ribonuclease P protein subunit p25 like protein|Ribonuclease P/MRP 25kDa subunit like|MGC29635|Rpp25 like protein|RNase P protein subunit like p25
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q8N5L8
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 163 of human RPP25L (NP_680544.1)
- Sequence:
- MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
- Form:
- Liquid
- Molecular Weight:
- 18 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C