Anti-ARF6 Rabbit Monoclonal Antibody [Clone: ARC0617]
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit monoclonal [ARC0617] antibody to ARF6 for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: ARF6
Clonality: Monoclonal
Clone: ARC0617
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat
Specifications
- Catalog No:
- 77221-326
- Antigen Symbol:
- ARF6
- Antigen Name:
- ADP ribosylation factor 6
- Antigen Synonyms:
- ADP ribosylation factor protein 6|Small GTP binding protein|ARF6|ARF6_HUMAN|ADP-ribosylation factor 6|Small GTPase|DKFZp564M0264
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC0617
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P62330
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 76-175 of human ARF6 (P62330).
- Sequence:
- HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
- Form:
- Liquid
- Molecular Weight:
- 18 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
- Tested Applications:
- ICC/IF