Order Entry
Puerto Rico
ContactUsLinkComponent
Anti-Crebbp Rabbit Polyclonal Antibody
Anti-Crebbp Rabbit Polyclonal Antibody
Supplier:  Antibodies.com
Certificates
undefined
Anti-Crebbp Rabbit Polyclonal Antibody
Supplier:  Antibodies.com

Specifications

  • Catalog No:
  • 77201-098
  • Antigen Symbol:
  • Crebbp
  • Antigen Name:
  • CBP
  • Antigen Synonyms:
  • CREB binding protein|RTS|RSTS|CBP_HUMAN|KAT3A / CBP|Crebbp|Cyclic AMP responsive enhancer binding protein|KAT3A|CREB-binding protein
  • Antibody Type:
  • Primary
  • Clonality:
  • Polyclonal
  • Conjugation:
  • Unconjugated
  • Reactivity:
  • Human, Rat, Mouse
  • Host:
  • Rabbit
  • Gene ID:
  • UniprotID# Q6GQV9
  • Isotype:
  • IgG
  • Western Blot:
  • Yes
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 1-445 of mouse CREBBP (Q6GQV9)
  • Sequence:
  • MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKSPLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQSMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTIL
  • Form:
  • Liquid
  • Molecular Weight:
  • 290 kDa
  • Purification:
  • Affinity purification
  • Storage Buffer:
  • Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
  • Storage Temperature:
  • Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
  • Shipping Temperature:
  • Shipped on blue ice at 4 °C

Specifications

Related Information

Frequently Bought Together