Anti-CaV1.3 Rabbit Polyclonal Antibody
Supplier: Antibodies.com
About this item
Rabbit polyclonal antibody to CaV1.3 for WB with samples derived from Human and Rat.
- Recommended Dilutions: WB: 1:500 to 1:200
Caution: This product is for Research Use Only. It is not for use in diagnostic or therapeutic procedures.
Type: Primary
Antigen: CaV1.3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human;Rat
1 Options Available Below
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
Rabbit polyclonal antibody to CaV1.3 for WB with samples derived from Human and Rat.
- Recommended Dilutions: WB: 1:500 to 1:200
Caution: This product is for Research Use Only. It is not for use in diagnostic or therapeutic procedures.
Type: Primary
Antigen: CaV1.3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human;Rat
Documents
Specifications for Product Family
Specifications
- Catalog No:
- 77206-670
- 77214-102
- Antigen Symbol:
- CaV1.3
- CaV1.3
- Antigen Name:
- alpha-1 polypeptide
- alpha-1 polypeptide
- Antigen Synonyms:
- Calcium channel L type alpha 1 polypeptide isoform 2|CACNA 1D|CACNL1A2|Calcium channel|CACN4|CAC1D_HUMAN|CACH3|Cacna1d|Calcium channel neuroendocrine/brain type alpha 1 subunit
- Calcium channel L type alpha 1 polypeptide isoform 2|CACNA 1D|CACNL1A2|Calcium channel|CACN4|CAC1D_HUMAN|CACH3|Cacna1d|Calcium channel neuroendocrine/brain type alpha 1 subunit
- Antibody Type:
- Primary
- Primary
- Clonality:
- Polyclonal
- Polyclonal
- Conjugation:
- Unconjugated
- Unconjugated
- Reactivity:
- Human|Rat
- Human|Rat
- Host:
- Rabbit
- Rabbit
- Gene ID:
- UniprotID# Q01668
- UniprotID# Q01668
- Isotype:
- IgG
- IgG
- Western Blot:
- Yes
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1882-2181 of human CACNA1D (NP_000711.1)
- Recombinant fusion protein containing a sequence corresponding to amino acids 1882-2181 of human CACNA1D (NP_000711.1)
- Sequence:
- RQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVRPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTL
- RQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVRPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTL
- Form:
- Liquid
- Liquid
- Molecular Weight:
- 245 kDa
- 245 kDa
- Purification:
- Affinity purification
- Affinity purification
- Concentration:
- Lot specific
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
- Shipped on blue ice at 4 °C
Specifications
Product Family Options
Product Information
- SizePackagingAvailabilityPrice
- 50 µlPlastic vialDiscontinued-Supplier Number: -Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.Specifications:
More
Specifications
Cat. No.77206-670Antigen SymbolCaV1.3Antigen Namealpha-1 polypeptideAntigen SynonymsCalcium channel L type alpha 1 polypeptide isoform 2|CACNA 1D|CACNL1A2|Calcium channel|CACN4|CAC1D_HUMAN|CACH3|Cacna1d|Calcium channel neuroendocrine/brain type alpha 1 subunitAntibody TypePrimaryClonalityPolyclonalConjugationUnconjugatedReactivityHuman|RatHostRabbitGene IDUniprotID# Q01668IsotypeIgGWestern BlotYesImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 1882-2181 of human CACNA1D (NP_000711.1)SequenceRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVRPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTLFormLiquidMolecular Weight245 kDaPurificationAffinity purificationConcentrationStorage BufferSupplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% ThiomersalStorage TemperatureShipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.Shipping TemperatureShipped on blue ice at 4 °C - Supplier Number: A93183-100Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.Specifications:
More
Specifications
Cat. No.77214-102Antigen SymbolCaV1.3Antigen Namealpha-1 polypeptideAntigen SynonymsCalcium channel L type alpha 1 polypeptide isoform 2|CACNA 1D|CACNL1A2|Calcium channel|CACN4|CAC1D_HUMAN|CACH3|Cacna1d|Calcium channel neuroendocrine/brain type alpha 1 subunitAntibody TypePrimaryClonalityPolyclonalConjugationUnconjugatedReactivityHuman|RatHostRabbitGene IDUniprotID# Q01668IsotypeIgGWestern BlotYesImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 1882-2181 of human CACNA1D (NP_000711.1)SequenceRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVRPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTLFormLiquidMolecular Weight245 kDaPurificationAffinity purificationConcentrationLot specificStorage BufferSupplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium AzideStorage TemperatureShipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.Shipping TemperatureShipped on blue ice at 4 °C



