Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Size:0.1 mg
- Storage Conditions:Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week
- Reconstitution Instructions:Add 0.1 M Acetate buffer pH=4.0 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely at 37 °C. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/ml. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
- Protein Synonyms:POSTN|OSF-2|PN|NCK|Periostin|Osteoblast Specific Factor 2 (Pleiotrophin, PTN, Heparin-binding growth-associated molecule, HB-GAM, Heparin-binding growth factor 8, HBGF-8, OSF-2, Heparin-binding neurite outgrowth-promoting factor 2, HBNF-2, Heparin-binding brain mitogen, HBBM ) |Fasciclin-I like
- Protein/Peptide Name:Osteoblast Specific Factor 2 Human E. coli
- Purity:> 90%
- Molecular Weight:75 kDa (calculated)
- Sequence:MGHHHHHHHHHHSSGHIEGRHMRNNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERFMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMVQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVY
- Formulation:Filtered (0.4 μm) and lyophilized in 0.5 mg/ml in 0.05 M Acetate buffer pH=4.0
- Shipping Temperature:On ice
- Tested Applications:Western blotting, ELISA
- Cat. No.:103783-256
Specifications
About this item
Total 671 AA. MW: 75 kDa (calculated). UniProtKB acc.no. Q15063. N-Terminal HisTag and Xa – cleavage site 23 AA (highlighted).
- Quality Control Test
- BCA to determine quantity of the protein
- SDS PAGE to determine purity of the protein
- LAL to determine quantity of endotoxin