NT-proANP Human E. coli, 0.1 mg
103739-852
:
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Size:0.1 mg
- Storage Conditions:Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week
- Endotoxin Content:<0.1 EU/μg
- Reconstitution Instructions:Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
- Protein Synonyms:N-terminal proatrial natriuretic peptide
- Protein/Peptide Name:NT-proANP Human E. coli
- Purity:> 95%
- Molecular Weight:11.7 kDa (calculated)
- Sequence:MKHHHHHHNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR
- Endotoxin Level:<0.1 EU/μg
- Formulation:Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in 20 mM Tris buffer, 50 mM NaCl, 5 % w/v trehalose, pH 7.5
- Shipping Temperature:At ambient temperature
- Tested Applications:Western blotting, ELISA
- Cat. No.:103739-852
Total 106 AA. MW: 11.7 kDa (calculated). UniProtKB acc. No. P01160 (Asn26–Arg123). N-terminal His-tag (8 extra AA). Protein identity confirmed by LC-MS/MS.
- Quality Control Test
- BCA to determine quantity of the protein
- SDS PAGE to determine purity of the protein
- LAL to determine quantity of endotoxin
: Research use only.