Order Entry
Puerto Rico
ContactUsLinkComponent
 
NT-proANP Human E. coli, 0.1 mg
  103739-852
 :  BioVendor
 :  
undefined
NT-proANP Human E. coli, 0.1 mg
  103739-852
 :  BioVendor
 :  RD172485100
 :  

 

  • Conjugation:
    Unconjugated
  • Protein/Peptide Type:
    Recombinant
  • Source:
    E. coli
  • Species:
    Human
  • Size:
    0.1 mg
  • Storage Conditions:
    Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week
  • Endotoxin Content:
    <0.1 EU/μg
  • Reconstitution Instructions:
    Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
  • Protein Synonyms:
    N-terminal proatrial natriuretic peptide
  • Protein/Peptide Name:
    NT-proANP Human E. coli
  • Purity:
    > 95%
  • Molecular Weight:
    11.7 kDa (calculated)
  • Sequence:
    MKHHHHHHNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR
  • Endotoxin Level:
    <0.1 EU/μg
  • Formulation:
    Filtered (0.4 μm) and lyophilized from 0.5 mg/ml solution in 20 mM Tris buffer, 50 mM NaCl, 5 % w/v trehalose, pH 7.5
  • Shipping Temperature:
    At ambient temperature
  • Tested Applications:
    Western blotting, ELISA
  • Cat. No.:
    103739-852

 

 

Total 106 AA. MW: 11.7 kDa (calculated). UniProtKB acc. No. P01160 (Asn26–Arg123). N-terminal His-tag (8 extra AA). Protein identity confirmed by LC-MS/MS.

  • Quality Control Test
  • BCA to determine quantity of the protein
  • SDS PAGE to determine purity of the protein
  • LAL to determine quantity of endotoxin
 : Research use only.