Anti-ZNF530 Rabbit Polyclonal Antibody
103285-896
- Antibody Type:Primary
- Antigen Symbol:ZNF530
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:348327
- Antigen Synonyms:KIAA1508|zinc finger protein 530
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids: LQMIELHASPCGQKLYLGGASRDFWMSSNLHQLQKLDNGEKLFKVDGDQA SFMMNCRFHVSGKPFTFGEVGRDF
- Purification:Immunogen affinity purified
- Cat. No.:103285-896
- Supplier no.:NBP2-13580
The ZNF530 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF530. This antibody reacts with human. The ZNF530 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: ZNF530
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human