Anti-SMG9 Rabbit Polyclonal Antibody
Catalog # 103283-690
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:SMG9
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:56006
- Antigen Synonyms:SMG9|DKFZp564H1322|F17127_1|FLJ12886|protein SMG9|Protein smg-9 homolog|chromosome 19 open reading frame 61
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids: SLYRFLQTAEMVKPSTPSPSHESSSSSGSDEGTEYYPHLVFLQNKARRED FCPRKLRQMHLMIDQLMAHSHLRYKGTLSMLQCNV
- Purification:Immunogen affinity purified
- Cat. No.:103283-690
- Supplier no.:NBP2-13354
Specifications
About this item
The SMG9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SMG9. This antibody reacts with human. The SMG9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: SMG9
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human