To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:SAP30
- Clonality:Monoclonal
- Clone:1D3
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 μg
- Environmentally Preferable:
- Gene ID:8819
- Antigen Synonyms:30 kDa Sin3-associated polypeptide|Sin3A-associated protein|Sin3-associated polypeptide p30|30kDa|histone deacetylase complex subunit SAP30|Sin3 corepressor complex subunit SAP30|sin3-associated polypeptide|30 kDa|Sin3-associated polypeptide
- Storage Buffer:PBS (pH 7.4)
- Storage Temperature:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
- Immunogen:SAP30 (NP_003855, 131 a.a. - 219 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV
- Purification:IgG purified
- Cat. No.:103335-686
- Supplier no.:H00008819-M03
Specifications
About this item
The SAP30 Antibody (1D3) from Novus Biologicals is a mouse monoclonal antibody to SAP30. This antibody reacts with human. The SAP30 Antibody (1D3) has been validated for the following applications: Western Blot, ELISA.
Type: Primary
Antigen: SAP30
Clonality: Monoclonal
Clone: 1D3
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human