Anti-PRPF38A Rabbit Polyclonal Antibody
Catalog # 103288-156
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:PRPF38A
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:84950
- Antigen Synonyms:RP5-965L7.1|Prp38|FLJ14936|pre-mRNA-splicing factor 38A|MGC3320|PRP38 pre-mRNA processing factor 38 (yeast) domain containing A
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against a recombinant protein corresponding to amino acids: NEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVL
- Purification:Immunogen affinity purified
- Cat. No.:103288-156
- Supplier no.:NBP2-33673
Specifications
About this item
The PRPF38A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRPF38A. This antibody reacts with human. The PRPF38A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: PRPF38A
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human