Anti-OR5T3 Rabbit Polyclonal Antibody
Catalog # 103280-770
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:OR5T3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:390154
- Antigen Synonyms:Olfactory receptor OR11-178|OR5T3Q|member 3|olfactory receptor 5T3|OR11-178|subfamily T|family 5|olfactory receptor
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:STFTGYNLYNLQVKTEMDKLSSGLDIYRNPLKNKTEVTMF
- Purification:Immunogen affinity purified
- Cat. No.:103280-770
- Supplier no.:NBP1-92230
Specifications
About this item
The OR5T3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OR5T3. This antibody reacts with human. The OR5T3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: OR5T3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human