Anti-Frequenin Rabbit Polyclonal Antibody
103277-342
- Antibody Type:Primary
- Antigen Name:Frequenin
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human,Mouse
- Western Blot:Yes
- Size:100 μl
- Gene ID:23413
- Antigen Synonyms:FREQFLUP|NCS-1|frequenin homolog (Drosophila)|neuronal calcium sensor 1|Frequenin-like ubiquitous protein|Frequenin-like protein|frequenin (Drosophila) homolog|DKFZp761L1223|Frequenin homolog
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
- Purification:Immunogen affinity purified
- Cat. No.:103277-342
- Supplier no.:NBP1-89820
The Frequenin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Frequenin. This antibody reacts with human, mouse. The Frequenin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: Frequenin
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse