Anti-DNA Primase small subunit Rabbit Polyclonal Antibody
103278-126
- Antibody Type:Primary
- Antigen Name:DNA Primase small subunit
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:5557
- Antigen Synonyms:primase|MGC12308|DNA|primase polypeptide 1|p49|primase p49 subunit|EC 2.7.7|DNA primase small subunit|polypeptide 1 (49kDa)|DNA primase 1|DNA primase subunit 48|EC 2.7.7.-|DNA primase 49 kDa subunit|49kDa
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:ELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSG
- Purification:Immunogen affinity purified
- Cat. No.:103278-126
- Supplier no.:NBP1-90897
The DNA Primase small subunit Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA Primase small subunit. This antibody reacts with human. The DNA Primase small subunit Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: DNA Primase small subunit
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human