Anti-Chondroitin sulfate synthase 3 Rabbit Polyclonal Antibody
103269-024
- Antibody Type:Primary
- Antigen Name:Chondroitin sulfate synthase 3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:337876
- Antigen Synonyms:EC 2.4.1.175|CSS3N-acetylgalactosaminyltransferase 3|Glucuronosyl-N-acetylgalactosaminyl-proteoglycan4-beta-N-acetylgalactosaminyltransferase II|ChSy-2|Chondroitin synthase 2|chondroitin sulfate synthase 3|Carbohydrate synthase 2|EC 2.4.1.226|chondroitin synthase-2|CHSY2|N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 3|Chondroitin glucuronyltransferase 3
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:LVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFR
- Purification:Immunogen affinity purified
- Cat. No.:103269-024
- Supplier no.:NBP1-85626
The Chondroitin sulfate synthase 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Chondroitin sulfate synthase 3. This antibody reacts with human. The Chondroitin sulfate synthase 3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: Chondroitin sulfate synthase 3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human