Anti-EEF1A2 Rabbit Polyclonal Antibody
Catalog # 103282-828
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:EEF1A2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:1917
- Antigen Synonyms:statin|HS1|STN|EF1A|STNL|eEF1A-2|EF-1-alpha-2|statin-like|EEF1ALFLJ41696|statin S1|elongation factor 1-alpha 2|elongation factor-1 alpha|Statin-S1|Eukaryotic elongation factor 1 A-2|eukaryotic translation elongation factor 1 alpha 2
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against a recombinant protein corresponding to amino acids: LLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGIL
- Purification:Immunogen affinity purified
- Cat. No.:103282-828
- Supplier no.:NBP2-33280
Specifications
About this item
The EEF1A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EEF1A2. This antibody reacts with human. The EEF1A2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: EEF1A2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human