Anti-C4orf21/prematurely terminated mRNA decay factor-like Rabbit Polyclonal Antibody
Catalog # 103268-090
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:C4orf21/prematurely terminated mRNA decay factor-like
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:55345
- Antigen Synonyms:DKFZp313L226|chromosome 4 open reading frame 21|DKFZp434C0927
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:ESEQLKELHALMKEDLTPTERVYVRKSIEQHKLGTNRTLLKQVRVVGVTCAACPFPCMNDLKFPVVVLDECSQITEPASLLPIARFEC
- Purification:Immunogen affinity purified
- Cat. No.:103268-090
- Supplier no.:NBP1-83750
Specifications
About this item
The C4orf21 / prematurely terminated mRNA decay factor-like Antibody from Novus Biologicals is a rabbit polyclonal antibody to C4orf21 / prematurely terminated mRNA decay factor-like. This antibody reacts with human. The C4orf21 / prematurely terminated mRNA decay factor-like Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: C4orf21/prematurely terminated mRNA decay factor-like
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human