Anti-17 beta-HSD1/HSD17B1 Rabbit Polyclonal Antibody
Catalog # 103268-752
Supplier: Novus Biologicals
Specifications
- Antibody Type:Primary
- Antigen Symbol:17 beta-HSD1/HSD17B1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:3292
- Antigen Synonyms:EC 1.1.1.62|estradiol 17-beta-dehydrogenase 1|hydroxysteroid (17-beta) dehydrogenase 1 isoform|HSD17|E17KSR|MGC138140|Placental 17-beta-hydroxysteroid dehydrogenase|hydroxysteroid (17-beta) dehydrogenase 1|SDR28C1|17-beta-hydroxysteroid dehydrogenase type 1|short chain dehydrogenase/reductase family 28CE|member 1|20-alpha-HSD|E2DH|EDH17B2EDHB17|EDH17B1|17-beta-HSD 1|estradiol 17-beta-dehydrogenase-1|20 alpha-hydroxysteroid dehydrogenase
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:FGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPKPTL
- Purification:Immunogen affinity purified
- Cat. No.:103268-752
- Supplier no.:NBP1-84901
Specifications
About this item
The 17 beta-HSD1 / HSD17B1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 17 beta-HSD1 / HSD17B1. This antibody reacts with human. The 17 beta-HSD1 / HSD17B1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: 17 beta-HSD1/HSD17B1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human