Anti-PRKAB2 IgG Polyclonal Antibody
Catalog # 76174-294
Supplier: Boster Biological Technology
Specifications
- Antibody Type:Primary
- Antigen Symbol:PRKAB2
- Clonality:Polyclonal
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western Blot:Yes
- Size:100 µg/vial
- Form:Lyophilized
- Gene ID:O43741
- Molecular Weight:30302
- Storage Temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Concentration:Add 0.2ml of distilled water will yield a concentration of 500 μg/ml.
- Shipping Temperature:4°C
- Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
- Purification:Immunogen affinity purified.
- Cat. No.:76174-294
Specifications
About this item
Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-2(PRKAB2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Type: Primary
Antigen: PRKAB2
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: IgG
Isotype: Rabbit
Reactivity: Human; Mouse; Rat