Anti-PRKAB1 IgG Polyclonal Antibody
76174-292
- Antibody Type:Primary
- Antigen Symbol:PRKAB1
- Clonality:Polyclonal
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 µg/vial
- Form:Lyophilized
- Gene ID:Q9Y478
- Molecular Weight:30382
- Storage Temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Concentration:Add 0.2ml of distilled water will yield a concentration of 500 μg/ml.
- Shipping Temperature:4°C
- Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 1 (32-68aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.
- Purification:Immunogen affinity purified.
- Cat. No.:76174-292
Rabbit IgG polyclonal antibody for 5'-AMP-activated protein kinase subunit beta-1(PRKAB1) detection. Tested with WB in Human.
Type: Primary
Antigen: PRKAB1
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: IgG
Isotype: Rabbit
Reactivity: Human