Specifications
- Antibody Type:Primary
- Antigen Name:high mobility group box 3
- Antigen Symbol:HMGB3
- Clonality:Polyclonal
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western Blot:Yes
- Size:100 µg/vial
- Form:Lyophilized
- Gene ID:O15347
- Antigen Synonyms:HMG4|HMG-2a|HMG-4|HMG2A
- UniProtKB:O15347
- Molecular Weight:22980
- Storage Temperature:At −20˚C for one year. After reconstitution, at 4 ˚C for one month. It can also be aliquotted and stored frozen at −20 ˚C for a longer time. Avoid repeated freezing and thawing.
- Concentration:Add 0.2 ml of distilled water will yield a concentration of 500 μg/ml
- Shipping Temperature:4 °C
- Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences.
- Purification:Immunogen affinity purified
- Cat. No.:76174-122
Specifications
About this item
Rabbit IgG polyclonal antibody for High mobility group protein B3(HMGB3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Type: Primary
Antigen: HMGB3
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: IgG
Isotype: Rabbit
Reactivity: Human; Mouse; Rat