Anti-MB IgG Polyclonal Antibody
Catalog # 76171-802
Supplier: Boster Biological Technology
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:MB
- Clonality:Polyclonal
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 µg/vial
- Form:Lyophilized
- Gene ID:P02144
- Molecular Weight:17184
- Storage Temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Concentration:Add 0.2ml of distilled water will yield a concentration of 500 μg/ml.
- Shipping Temperature:4°C
- Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human Myoglobin (3-35aa LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK), different from the related mouse sequence by three amino acids, and from the related rat sequence by six amino acids.
- Purification:Immunogen affinity purified.
- Cat. No.:76171-802
Specifications
About this item
Rabbit IgG polyclonal antibody for Myoglobin(MB) detection. Tested with WB in Human.
Type: Primary
Antigen: MB
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: IgG
Isotype: Rabbit
Reactivity: Human