Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Species:Rabies virus
- Size:1 mg
- Storage Conditions:–20 °C
- Protein Synonyms:Rabies glycoprotein Peptide|RVG Peptide|RVG-9R Peptide
- Protein/Peptide Name:Chimeric Rabies Virus Glycoprotein Fragment
- Purity:95%
- Molecular Weight:4843.5 Da
- Sequence:YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
- Cat. No.:103006-656
- Supplier no.:AS-62565
Specifications
About this item
This chimeric peptide is a fragment derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice, RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.
Sequence:YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
MW:4843.5 Da
% peak area by HPLC:95
Storage condition:-20° C