Order Entry
Puerto Rico
ContactUsLinkComponent
 
Ryanodine receptor 1 Peptide
  103008-282
 :  
Ryanodine receptor 1 Peptide
  103008-282
 :  AS-64606
 :  

Some Products May Appear Restricted

To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.

If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)

 

If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation;  additional documentation will be requested for these items prior to shipment. 

 

  • Conjugation:
    Unconjugated
  • Size:
    1 mg
  • Storage Conditions:
    –20 °C
  • Protein Synonyms:
    RyR1 Peptide|CaMBP
  • Protein/Peptide Name:
    Ryanodine receptor 1 Peptide
  • Purity:
    95%
  • Molecular Weight:
    3616.4 Da
  • Sequence:
    KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
  • Cat. No.:
    103008-282
  • Supplier no.:
    AS-64606

 

 

This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C