Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Size:1 mg
- Storage Conditions:–20 °C
- Protein Synonyms:Tau Peptide|Tau 306-336 Peptide|Tau (Repeat 3 domain) Peptide
- Protein/Peptide Name:Tau Peptide (306-336) (Repeat 3 domain)
- Purity:95%
- Molecular Weight:3248.51 Da
- Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
- Cat. No.:103009-742
- Supplier no.:AS-65435-1
Specifications
About this item
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C