Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Size:1 mg
- Storage Conditions:–20 °C
- Protein Synonyms:ryanodine receptor|ryanodine receptor fragment|cardiac ryanodine receptor|RYR2 fragment
- Protein/Peptide Name:Ryanodine receptor
- Purity:95%
- Molecular Weight:4103.9 Da
- Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
- Cat. No.:103008-442
- Supplier no.:AS-64769
Specifications
About this item
This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C