Order Entry
Puerto Rico
ContactUsLinkComponent
HIV TAT-HA2 Fusion Peptide
HIV TAT-HA2 Fusion Peptide
  103008-568
 :  
HIV TAT-HA2 Fusion Peptide
  103008-568
 :  AS-64876
 :  

Some Products May Appear Restricted

To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.

If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)

 

If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation;  additional documentation will be requested for these items prior to shipment. 

 

  • Conjugation:
    Unconjugated
  • Species:
    HIV
  • Size:
    1 mg
  • Storage Conditions:
    –20 °C
  • Protein Synonyms:
    Fusion TAT HA2|TAT fusion|HA2 TAT
  • Protein/Peptide Name:
    TAT-HA2 Fusion Peptide
  • Purity:
    95%
  • Molecular Weight:
    3433 Da
  • Sequence:
    RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
  • Cat. No.:
    103008-568
  • Supplier no.:
    AS-64876

 

 

This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
MW: 3433 Da
% Peak area by HPLC: 95
Storage condition: -20°C