Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Conjugation:Unconjugated
- Species:Human
- Size:1 mg
- Storage Conditions:–20 °C
- Protein Synonyms:amyloid beta (1-40) Cys|beta amyloid (1-40) Cys|abeta (1-40) Cys|amyloid 1-40 Cys
- Protein/Peptide Name:Cys-beta-Amyloid (1-40)
- Purity:95%
- Molecular Weight:4433 Da
- Sequence:CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat. No.:102999-606
- Supplier no.:AS-23520
Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C