Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:Unconjugated
- Species:Human
- Size:0.5 mg
- Storage Conditions:–20 °C
- Protein Synonyms:amyloid beta (1-40) Iowa mutation|beta amyloid (1-40) Iowa mutation|abeta (1-40) Iowa mutation|amyloid 1-40 Iowa mutation
- Protein/Peptide Name:[Asn23]-beta-Amyloid (1-40)
- Purity:95%
- Molecular Weight:4328.9 Da
- Sequence:DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
- Cat. No.:103007-210
- Supplier no.:AS-62145
Specifications
About this item
This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C