To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Conjugation:Biotin
- Species:RatMouse
- Size:0.1 mg
- Storage Conditions:–20 °C
- Protein Synonyms:abeta (1-40) Lys(Biotin)|amyloid beta (1-40) Lys(Biotin)|beta amyloid (1-40) Lys(Biotin)|amyloid 1-40 Lys(Biotin)
- Protein/Peptide Name:beta-Amyloid (1-40)-Lys(Biotin)-NH2
- Purity:95%
- Molecular Weight:4587.3 Da
- Sequence:DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
- Cat. No.:103007-614
- Supplier no.:AS-63356
Specifications
About this item
This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C