Order Entry
Puerto Rico
ContactUsLinkComponent
Mouse;Rat Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Biotin
Mouse;Rat Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Biotin
Catalog # 103007-614
Supplier:  Anaspec Inc
CAS Number:  
Mouse;Rat Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Biotin
Catalog # 103007-614
Supplier:  Anaspec Inc
Supplier Number:  AS-63356
CAS Number:  
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Conjugation:
    Biotin
  • Species:
    Rat
    Mouse
  • Size:
    0.1 mg
  • Storage Conditions:
    –20 °C
  • Protein Synonyms:
    abeta (1-40) Lys(Biotin)|amyloid beta (1-40) Lys(Biotin)|beta amyloid (1-40) Lys(Biotin)|amyloid 1-40 Lys(Biotin)
  • Protein/Peptide Name:
    beta-Amyloid (1-40)-Lys(Biotin)-NH2
  • Purity:
    95%
  • Molecular Weight:
    4587.3 Da
  • Sequence:
    DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
  • Cat. No.:
    103007-614
  • Supplier no.:
    AS-63356

Specifications

About this item

This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C