Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Conjugation:HiLyte™ Fluor 488
- Species:Human
- Size:0.1 mg
- Storage Conditions:–20 °C
- Protein Synonyms:amyloid beta (11-42) HiLyte™ Fluor 488|abeta (11-42) HiLyte™ Fluor 488|amyloid 11-42 HiLyte™ Fluor 488|beta amyloid (11-42) HiLyte™ Fluor 488
- Protein/Peptide Name:beta-Amyloid (11-42)
- Purity:95%
- Molecular Weight:3692.3 Da
- Sequence:HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
- Cat. No.:103007-610
- Supplier no.:AS-63327
Specifications
About this item
This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyte™ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyte™ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C