About this item
Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.
- High quality
- Low endotoxin
- Affordable
To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Conjugation:Unconjugated
- Protein Function:Cytokine
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Mouse
- Storage Conditions:−20 °C
- Endotoxin Content:Endotoxin LAL (EU/µg) ≤0.1
- Biological Activity:Bioactivity: No biological activity data is available at this time
- Form:Lyophilized
- Gene ID:Q8CJ70
- Reconstitution Instructions:Sterile water at 0.1 mg/ml
- Endotoxin-free:N
- Carrier-Free:Y
- Protease-free:N
- Animal-Free:N
- Protein Synonyms:IL19|IL-19|Interleukin 19
- UniProtKB:Q8CJ70
- Protein/Peptide Name:IL-19
- Purity:≥95%
- Molecular Weight:17.7 kDa
- Sequence:MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
- Endotoxin Level:Low
- Formulation:10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
- Nuclease-free:N
- Grade:RUO
- Shipping Temperature:RT