Order Entry
United States
ContactUsLinkComponent
Anti-alpha Actinin 2 Rabbit Polyclonal Antibody
Anti-alpha Actinin 2 Rabbit Polyclonal Antibody
Catalog # 102019-486
Supplier:  Avantor
Anti-alpha Actinin 2 Rabbit Polyclonal Antibody
Catalog # 102019-486
Supplier:  Avantor
Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • • State issued document with your organization's Federal Tax ID Number
  • • State issued document with your organization's Resale Tax ID Number
  • • City or County issued Business License
  • • State Department of Health Services License
  • • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Specifications

  • Antibody Type:
    Primary
  • Antigen Name:
    alpha Actinin 2
  • Clonality:
    Polyclonal
  • Conjugation:
    Unconjugated
  • Host:
    Rabbit
  • Isotype:
  • Reactivity:
  • Western Blot:
    Yes
  • Size:
    50 µg
  • Environmentally Preferable:
  • Format:
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACTN2 antibody in PBS
  • Storage Temperature:
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Concentration:
    1 mg/ml
  • Immunogen:
    alpha Actinin 2 antibody was raised using the N terminal of ACTN2 corresponding to a region with amino acids NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH
  • Cat. No.:
    102019-486
  • Supplier no.:
    70R2259

Specifications

About this item

The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres.

WB: 1 ug/ml

Type: Primary
Antigen: alpha Actinin 2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: