Anti-RDBP Rabbit Polyclonal Antibody
- Item requires temperature control for storage and delivery with additional fees. It's not eligible for return due to safety and quality concerns. Consider requirements before purchasing.
- Return Policy
Product Details & Documents
RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D). The protein encoded by this gene is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation.
WB: 1 ug/ml
Type: Primary
Antigen: RDBP
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity:
Specifications
- Size:50 µg
- Cat. No.:102024-228
- Clonality:Polyclonal
- Western Blot:Yes
- Format:Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RDBP antibody in PBS
- Antibody Type:Primary
- Antigen Symbol:RDBP
- Immunogen:RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids QSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNS
- Host:Rabbit
- Conjugation:Unconjugated
- Concentration:1 mg/ml
- Storage Temperature:Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Recommendations will be personalized based on your shopping preferences only if you have given your consent by enabling "Enhance my Shopping Experience" on the "Personal Info page".
Otherwise, you will receive generic recommendations.