Anti-KIAA0692 Rabbit Polyclonal Antibody
Catalog # 102021-476
Supplier: Avantor
Specifications
- Antibody Type:Primary
- Antigen Symbol:KIAA0692
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Western Blot:Yes
- Size:50 µg
- Format:Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0692 antibody in PBS
- Storage Temperature:Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Concentration:1 mg/ml
- Immunogen:KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG
- Cat. No.:102021-476
- Supplier no.:70R3254
Specifications
About this item
KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.
WB: 1 ug/ml
Type: Primary
Antigen: KIAA0692
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: