Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Conjugation:Unconjugated
- Species:Human
- Size:0.5 mg
- Storage Conditions:–20 °C
- Protein Synonyms:beta amyloid (1-42) Italian mutation|amyloid beta (1-42) Italian mutation|amyloid 1-42 Italian mutation|abeta (1-42) Italian mutation
- Protein/Peptide Name:[Lys22]-beta-Amyloid (1-42)
- Purity:95%
- Molecular Weight:4513.2 Da
- Sequence:DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
- Shipping Temperature:ambient
- Cat. No.:103007-216
- Supplier no.:AS-62148
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C