Order Entry
Puerto Rico
Orders LinkContactUsLinkComponent
 

Human Osteoblast Specific Fa (from E. coli)

100 µg
  101215-256
Marketsource
 :   BioVendor
 :  RD172045100
Human Osteoblast Specific Fa (from <i>E. coli</i>)
  101215-256
 :  BioVendor
Marketsource
 :  
Human Osteoblast Specific Fa (from <i>E. coli</i>)
Human Osteoblast Specific Fa (from E. coli)

100 µg

 :  
 
$583.35
   
Each (100µG)
 
   
 

Total 671 AA. MW: 75 kDa (calculated). UniProtKB acc.no. Q15063. N-Terminal HisTag and Xa – cleavage site 23 AA (highlighted).

  • Quality Control Test
  • BCA to determine quantity of the protein
  • SDS PAGE to determine purity of the protein
  • LAL to determine quantity of endotoxin

 : For research use only.

 

 

  • Size:
    100 µg
  • Storage Conditions:
    Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week
  • Molecular Weight:
    75 kDa (calculated)
  • Reconstitution Instructions:
    Add 0.1M Acetate buffer pH=4.0 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely at 37 °C. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/ml. In higher concentrations the solubility of this antigen is limited. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
  • Purity:
    >90%
  • Tested Applications:
    Western blotting, ELISA
  • Sequence:
    MGHHHHHHHHHHSSGHIEGRHMRNNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERFMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMVQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVY
  • Source:
    E. coli
  • Cat. No.:
    101215-256
  • Shipping Temperature:
    On ice
  • Protein/Peptide Type:
    Recombinant
  • Formulation:
    Filtered (0.4 μm) and lyophilized in 0.5 mg/ml in 0.05 M acetate buffer pH=4.0
  • Protein Synonyms:
    POSTN|OSF-2|PN|Osteoblast Specific Fa|Periostin|Fasciclin-I like
  • Protein/Peptide Name:
    Osteoblast Specific Factor 2 Human E. coli
  • Conjugation:
    Unconjugated
  • Species:
    Human

 

Some Products May Appear Restricted

To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.

If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)

 

If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation;  additional documentation will be requested for these items prior to shipment.