Anti-APOBPEC3B Rabbit Polyclonal Antibody
89269-216
: Genetex
- Antibody Type:Primary
- Antigen Name:Apolipoprotein B mRNA Editing Enzyme Catalytic Polypeptide-Like 3B
- Antigen Symbol:APOBPEC3B
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:50 μg
- Gene ID:9582
- Antigen Synonyms:ARCD3|PHRBNL|APOBEC1L|A3B|DJ742C19.2|ARP4|bK150C2.2
- Storage Buffer:Phosphate buffered saline (PBS)
- Storage Temperature:Store at 4 °C for short-term use. For longer periods of storage, aliquot and store at –20 °C. Avoid repeat freeze-thaw cycles.
- Concentration:1 mg/ml
- Immunogen:Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW
- Purification:Peptide Affinity Purified
- Cat. No.:89269-216
- Supplier no.:GTX46485
Rabbit polyclonal antibody to APOBEC3B (N-terminal)
Recommended Dilutions: For Western Blot: Use at 0.25 ug/ml.
Not yet tested in other applications. Optimal dilutions should be determined experimentally by the researcher.
Type: Primary
Antigen: APOBPEC3B
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human