Specifications
- Antibody Type:Primary
- Antigen Name:Agouti Related Neuropeptide
- Antigen Symbol:AGRP
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Guinea pig
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Sheep,Human,Rat
- Size:50 µL
- Epitope:carboxy domain of Mouse agouti related protein
- Cross Adsorption:No
- Format:Lyophilized
- Immunogen:A synthetic peptide (SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT) corresponding to a region (82-131) within the carboxy domain of mouse agouti related protein. This peptide was conjugated to carrier protein to enhance the immunological response.
- Cat. No.:10782-008
- Supplier no.:GP-029-50
Specifications
About this item
AGRP is the endogenous antagonist of alpha-melanocyte stimulating hormone and has been shown to cause potent stimulation of food intake, and this protein is found in over 90% of Neuropeptide Y containing cells in rats.
Specificity was demonstrated by immunohistochemistry.
Application Information:
IHC, frozen, PFA fixed material. Not yet tested on paraffin embedded tissue sections. A concentration of 1:1000 to 1:2000 is recommended for IHC with overnight incubations. Permeabilization suggested is 0.1% triton X-100 in blocking buffer. IHC performed in sheep brain (hypothalamus) demonstrates intense staining of cells and terminals. No staining is evident when the primary antibody is pre-absorbed with 0.5 mg/ml of AGRP. In rodents such as rat cell terminal staining is most typically observed without cell body staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Type: Primary
Antigen: AGRP
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope: carboxy domain of Mouse agouti related protein
Host: Guinea Pig
Isotype: IgG
Reactivity: Human, Rat, Sheep