To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:Chemokine (C-C motif) Ligand 3
- Antigen Symbol:CCL3
- Clonality:Monoclonal
- Clone:2E9
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 µg
- Environmentally Preferable:
- Cross Adsorption:No
- Format:Liquid
- Gene ID:6348
- Antigen Synonyms:G0S19-1|SCYA3|LD78ALPHA|MIP-1-alpha|MIP1A|C-C motif chemokine ligand 3
- Amino Acid Number:24 to 92
- Storage Buffer:1x PBS, pH 7.4
- Sequence:SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Storage Temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:CCL3 (NP_002974, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Cat. No.:10578-914
- Supplier no.:H00006348-M03
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant CCL3.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: CCL3
Clonality: Monoclonal
Clone: 2E9
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1
Reactivity: Human