Anti-MAP3K4 Mouse Monoclonal Antibody [clone: X1]
Catalog # 10625-206
Supplier: Abnova
Specifications
- Antibody Type:Primary
- Antigen Name:Mitogen-activated Protein Kinase Kinase Kinase 4
- Antigen Symbol:MAP3K4
- Clonality:Monoclonal
- Clone:X1
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2b
- Reactivity:Human,Mouse
- Western Blot:Yes
- Size:200 µL
- Cross Adsorption:No
- Format:Liquid
- Form:Ascites fluid
- Gene ID:4216
- Antigen Synonyms:MTK1|MEKK4|PRO0412|MEKK 4|MAPKKK4
- Amino Acid Number:1201 to 1300
- Sequence:AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS
- Storage Temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Cat. No.:10625-206
- Supplier no.:H00004216-M11A
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant MAP3K4.
Type: Primary
Antigen: MAP3K4
Clonality: Monoclonal
Clone: X1
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b
Reactivity: Human, Mouse