Anti-ATOX1 Mouse Monoclonal Antibody [clone: 3A13]
Catalog # 10581-064
Supplier: Abnova
Specifications
- Antibody Type:Primary
- Antigen Name:Antioxidant 1 Copper Chaperone
- Antigen Symbol:ATOX1
- Clonality:Monoclonal
- Clone:3A13
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2b kappa
- Reactivity:Human
- Western Blot:Yes
- Size:100 µg
- Cross Adsorption:No
- Format:Liquid
- Gene ID:475
- Antigen Synonyms:HAH1|ATX1
- Amino Acid Number:1 to 68
- Storage Buffer:1x PBS, pH 7.4
- Sequence:MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
- Storage Temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Cat. No.:10581-064
- Supplier no.:H00000475-M11
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant ATOX1.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: ATOX1
Clonality: Monoclonal
Clone: 3A13
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b kappa
Reactivity: Human