Anti-MRPL47 Rabbit Polyclonal Antibody
Catalog # 10725-858
Supplier: Abnova
Specifications
- Antibody Type:Primary
- Antigen Name:Mitochondrial Ribosomal Protein L47
- Antigen Symbol:MRPL47
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 µL
- Cross Adsorption:No
- Format:Liquid
- Gene ID:57129
- Antigen Synonyms:NCM1|L47mt|MRP-L47|CGI-204
- Storage Buffer:PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
- Sequence:LKERNMLLTLEQEAKRQRLPMPSPERLDKVVDSMDALDKVVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVI
- Storage Temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human MRPL47.
- Purification:Antigen affinity purification
- Cat. No.:10725-858
- Supplier no.:PAB23132
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant MRPL47.
Recommended Dilutions: Immunohistochemistry: 1:1000-1:2500; Western Blot: 1:250-1:500
Type: Primary
Antigen: MRPL47
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human