Anti-PYROXD2 Rabbit Polyclonal Antibody
10704-036
: Abnova
- Antibody Type:Primary
- Antigen Name:Pyridine Nucleotide-disulphide Oxidoreductase Domain 2
- Antigen Symbol:PYROXD2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 µL
- Cross Adsorption:No
- Format:Liquid
- Gene ID:84795
- Antigen Synonyms:FP3420|C10orf33
- Storage Buffer:PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
- Sequence:VVSLFTQYTPYTLAGGKAWDEQERDAYADRVFDCIEVYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFTRPVPLHSGYRC
- Storage Temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human C10orf33.
- Purification:Antigen affinity purification
- Cat. No.:10704-036
- Supplier no.:PAB23134
Rabbit polyclonal antibody raised against recombinant C10orf33.
Recommended Dilutions: Immunohistochemistry: 1:50-1:200; Western Blot: 1:250-1:500
Type: Primary
Antigen: PYROXD2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human