Anti-CACNA1H Rabbit Polyclonal Antibody
Catalog # 10704-668
Supplier: Abnova
Specifications
- Antibody Type:Primary
- Antigen Name:Calcium Channel, Voltage-dependent, T type, alpha 1H subunit
- Antigen Symbol:CACNA1H
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 µL
- Cross Adsorption:No
- Format:Liquid
- Gene ID:8912
- Antigen Synonyms:ECA6|EIG6|Calcium channel voltage-dependent T type alpha 1H subunit|Cav3.2|CACNA1HB
- Storage Buffer:PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
- Sequence:EEVSHITSSACPWQPTAEPHGPEASPVAGGERDLRRLYSVDAQGFLDKPGRADEQWRPSAELGSGEPGEAKAWGPEAEPALGARRKKKMSP
- Storage Temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human CACNA1H.
- Purification:Antigen affinity purification
- Cat. No.:10704-668
- Supplier no.:PAB23513
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant CACNA1H.
Recommended Dilutions: Immunohistochemistry: 1:10-1:20
Type: Primary
Antigen: CACNA1H
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG1
Reactivity: Human