Anti-PSMC1 Rabbit Polyclonal Antibody
Catalog # 10730-422
Supplier: Abnova
Specifications
- Antibody Type:Primary
- Antigen Name:Proteasome 26S Subunit, Atpase 1
- Antigen Symbol:PSMC1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western Blot:Yes
- Size:100 µL
- Cross Adsorption:No
- Format:Liquid
- Gene ID:5700
- Antigen Synonyms:p56|P26S4|S4
- Storage Buffer:PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
- Sequence:YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE
- Storage Temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human PSMC1.
- Purification:Antigen affinity purification
- Cat. No.:10730-422
- Supplier no.:PAB20010
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant PSMC1.
- Recommended Dilutions: Immunohistochemistry: 1:200-1:500; Western Blot: 1:250-1:500; Immunofluorescence: 1-4 μg/ml
Type: Primary
Antigen: PSMC1
Clonality: Unconjugated
Clone: Polyclonal
Conjugation:
Epitope:
Host: IgG
Isotype: Rabbit
Reactivity: Human, Mouse, Rat