Anti-GPR15 Rabbit Polyclonal Antibody
Catalog # 103270-698
Supplier: Avantor
Specifications
- Antibody Type:Primary
- Antigen Symbol:GPR15
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:2838
- Antigen Synonyms:BOB|G protein-coupled receptor 15|Brother of Bonzo|MGC126828|MGC126830|G-protein coupled receptor 15
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVF
- Purification:Immunogen affinity purified
- Cat. No.:103270-698
- Supplier no.:NBP1-87574
Specifications
About this item
The GPR15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GPR15. This antibody reacts with human. The GPR15 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: GPR15
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human